SAP PBDGTBYFISYR table - Generated Table for View details in SAP
Show table
SAP PBDGTBYFISYR table summary Object Name: PBDGTBYFISYR Dictionary Type: Table viewDescription: Generated Table for View
Field list for PBDGTBYFISYR table on an S/4 SAP system
Details
PBDGTBYFISYR-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
PBDGTBYFISYR-PROJECT table field - Project Number (External) Edited
▼
Description: Project Number (External) Edited Field Name: PROJECT Data Element: PS_PSPID_EDIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROJECT
PBDGTBYFISYR-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: FIS_GJAHR_NO_CONV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALYEAR
PBDGTBYFISYR-SEMANTICTAG table field - Semantic Tag of a Hierarchy Node
▼
Description: Semantic Tag of a Hierarchy Node Field Name: SEMANTICTAG Data Element: FINS_SEM_TAG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEMANTICTAG
PBDGTBYFISYR-GLOBALCURRENCY table field - Global Currency
▼
Description: Global Currency Field Name: GLOBALCURRENCY Data Element: FIS_RKCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLOBALCURRENCY
PBDGTBYFISYR-PROJECTPROFILECODE table field - Project Profile
▼
Description: Project Profile Field Name: PROJECTPROFILECODE Data Element: PROFIDPROJ Data Type: length (Dec): 0(0) Check table: TCJ41 Conversion Routine: Domain Name: MemoryID: PWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROJECTPROFILECODE
PBDGTBYFISYR-AVAILABILITYCONTROLPROFILE table field - Budget Availability Control: Profile
▼
Description: Budget Availability Control: Profile Field Name: AVAILABILITYCONTROLPROFILE Data Element: FCO_AVC_PROFILE Data Type: length (Dec): 0(0) Check table: FINSC_AVC_PROF Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVAILABILITYCONTROLPROFILE
PBDGTBYFISYR-AVAILABILITYCONTROLISACTIVE table field - Availability control indicator(AVC)
▼
Description: Availability control indicator(AVC) Field Name: AVAILABILITYCONTROLISACTIVE Data Element: PS_S4_AVC_IND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVAILABILITYCONTROLISACTIVE
PBDGTBYFISYR-AVAILYCTRLTIMERANGETYPE table field - Budget Availability Control: Time Range
▼
Description: Budget Availability Control: Time Range Field Name: AVAILYCTRLTIMERANGETYPE Data Element: FCO_AVC_TIME_RANGE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVAILYCTRLTIMERANGETYPE
PBDGTBYFISYR-PROJECTINTERNALID table field - Project (internal)
▼
Description: Project (internal) Field Name: PROJECTINTERNALID Data Element: PS_S4_PROJ_PSPNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROJECTINTERNALID
PBDGTBYFISYR-ACTUALAMOUNTINGLOBALCURRENCY table field -
▼
Description: Field Name: ACTUALAMOUNTINGLOBALCURRENCY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALAMOUNTINGLOBALCURRENCY
PBDGTBYFISYR-CURRENTDATE table field -
▼
Description: Field Name: CURRENTDATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENTDATE
PBDGTBYFISYR-INDICATORVALUE table field - Checkbox
▼
Description: Checkbox Field Name: INDICATORVALUE Data Element: XFELD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INDICATORVALUE
Search SAP tables